scholarly journals Halide and Thiocyanate Metal Acid Complexes Extraction in the Water – Ethoxylated Nonylphenol – Ammonium Sulfate System

2019 ◽  
pp. 328-335
Author(s):  
Anastasya V. Stankova ◽  
Aleksandr M. Elokhov ◽  
Andrey E. Lesnov
Keyword(s):  
Ammonium Sulfate ◽  
Spectrophotometric Determination ◽  
Inorganic Salts ◽  
Salting Out ◽  
Determination Methods ◽  
Ethoxylated Surfactants ◽  
Ethoxylated Nonylphenols ◽  
Group Concentration

Nonionic ethoxylated surfactants, including ethoxylated nonylphenols, can be considered as neutral oxygen-containing extraction reagents, the formation of delamination systems with which is possible when salting-out with inorganic salts. In this work, the distribution of halide and thiocyanate acid complexes of thallium (III), iron (III), indium and gallium in the water – ethoxylated nonylphenol (neonol AF 9-12) – ammonium sulfate system at 25°C was investigated. It is established that thallium (III) is quantitatively extracted in the form of tetrahalidetallate-ion with an acidity of more than 0.1 mol/l, extraction of other metals is not quantitative. Among the thiocyanate acid complexes, zinc, cobalt and copper (II) are quantitatively concentrated, which can be used for group concentration of these metals or their extraction-spectrophotometric determination methods

Salting-out Ability of Inorganic Salts in Solutions of Ethoxylated Nonylphenols

2018 ◽  
Vol 92 (7) ◽  
pp. 1386-1391 ◽  
Author(s):  
A. V. Stankova ◽  
A. M. Elokhov ◽  
O. S. Kudryashova
Keyword(s):  
Inorganic Salts ◽  
Salting Out ◽  
Ethoxylated Nonylphenols

scholarly journals Liquid–liquid phase separation in particles containing organics mixed with ammonium sulfate, ammonium bisulfate, ammonium nitrate or sodium chloride

2013 ◽  
Vol 13 (23) ◽  
pp. 11723-11734 ◽  
Author(s):  
Y. You ◽  
L. Renbaum-Wolff ◽  
A. K. Bertram
Keyword(s):  
Phase Separation ◽  
Sodium Chloride ◽  
Liquid Phase ◽  
Relative Humidity ◽  
Ammonium Sulfate ◽  
Inorganic Salt ◽  
Liquid Phase Separation ◽  
Inorganic Salts ◽  
Organic Species ◽  
Liquid Liquid Phase Separation

Abstract. As the relative humidity varies from high to low values in the atmosphere, particles containing organic species and inorganic salts may undergo liquid–liquid phase separation. The majority of the laboratory work on this subject has used ammonium sulfate as the inorganic salt. In the following we studied liquid–liquid phase separation in particles containing organics mixed with the following salts: ammonium sulfate, ammonium bisulfate, ammonium nitrate and sodium chloride. In each experiment one organic was mixed with one inorganic salt and the liquid–liquid phase separation relative humidity (SRH) was determined. Since we studied 23 different organics mixed with four different salts, a total of 92 different particle types were investigated. Out of the 92 types, 49 underwent liquid–liquid phase separation. For all the inorganic salts, liquid–liquid phase separation was never observed when the oxygen-to-carbon elemental ratio (O : C) &amp;geq; 0.8 and was always observed for O : C < 0.5. For 0.5 &amp;leq; O : C < 0.8, the results depended on the salt type. Out of the 23 organic species investigated, the SRH of 20 organics followed the trend: (NH4)2SO4 &amp;geq; NH4HSO4 &amp;geq; NaCl &amp;geq; NH4NO3. This trend is consistent with previous salting out studies and the Hofmeister series. Based on the range of O : C values found in the atmosphere and the current results, liquid–liquid phase separation is likely a frequent occurrence in both marine and non-marine environments.

scholarly journals DEVELOPMENT OF RECOMBINANT PEPTIDE TECHNOLOGY WITH ANTIMICROBIAL PROPERTIES OF A BROAD ACTION SPECTRUM

2017 ◽  
pp. 3-14
Author(s):  
Alexander Prosekov ◽  
Alexander Prosekov ◽  
Olga Babich ◽  
Olga Babich ◽  
Irina Milenteva ◽  
...  
Keyword(s):  
Molecular Weight ◽  
Ammonium Sulfate ◽  
Action Spectrum ◽  
Antimicrobial Properties ◽  
Hplc Method ◽  
Salting Out ◽  
Antimicrobial Spectrum ◽  
Recombinant Peptide ◽  
Isolation And Purification ◽  
Protein Nature

Bacteriocins are antibacterial, mainly complex, substances of protein nature. The promising strains producing bacteriocins used in the food industry are lactic acid microorganisms. This study examines the development of a technology for the production of a recombinant peptide with broad-spectrum antimicrobial properties. An important step is the isolation and purification of the recombinant peptide. It has been proved that the highest antimicrobial activity is manifested by a recombinant peptide isolated by a method based on salting out with ammonium sulfate. During the purification of the recombinant bacteriocin preparation, three kinds of columns were used. In the purification process, the volume of bacteriocin produced decreases 3-fold, while the RU/mL increases 3-fold, and RU/mg increases 6-fold. Purification allows the use of a smaller amount of recombinant bacteriocin in technologies with greater efficacy. Based on the results of determining the molecular weight and purity of the recombinant bacteriocin, it was found that the molecular weight of the recombinant bacteriocin having the amino acid sequence: KYYGNGVTCCKHSCSVDXGKASSCIINNGAMAXATGGH GGNHCCGMSRYIQGIPDFLRGYLHGISSANKHKKGRL, is 13 kDa. A technology for the preparation of a broad-action antimicrobial spectrum peptide has been developed. The process of production of antimicrobial peptide includes such stages as: cultivation of the recombinant strain of Escherichia coli BL21DE3; separation of biomass from the nutrient medium; precipitation of bacteriocins by ammonium sulfate; centrifugation; washing the precipitate; centrifugation at 4200 rpm and separation of the preparation; purification of bacteriocins by HPLC method; packing in bags of polymeric and combined materials; storage at a temperature of 18±2°C for 12 months.

Overcoming Antagonistic Effects of Na-Bentazon on Sethoxydim Absorption

1993 ◽  
Vol 7 (2) ◽  
pp. 322-325 ◽  
Author(s):  
Gunawan Wanamarta ◽  
James J. Kells ◽  
Donald Penner
Keyword(s):  
Ammonium Nitrate ◽  
Ammonium Sulfate ◽  
Ammonium Phosphate ◽  
Antagonistic Effect ◽  
Ammonium Salts ◽  
Inorganic Salts ◽  
Antagonistic Effects ◽  
Spray Solution

The influence of adjuvants, inorganic salts, and herbicide formulations on the antagonistic effect of Na-bentazon on sethoxydim absorption was studied in quackgrass. Adjuvant BCH 815 00, at 2.4 L ha−1alone or at 1.2 L ha−1combined with 1.1 kg ha−1of ammonium sulfate, added to the sethoxydim and Na-bentazon spray mixture overcame the antagonism on14C-sethoxydim absorption in quackgrass. Crop oil concentrate at rates up to 9.6 L ha−1did not overcome the antagonism. Adding ammonium phosphate or ammonium nitrate to the spray solution was as effective as adding ammonium sulfate in overcoming the antagonism caused by reduced absorption of sethoxydim even from the combination of Na-bentazon plus Na-acifluorfen. Ammonium salts and NH4-bentazon overcame the antagonism of Na-bentazon by forming readily absorbed NH4-sethoxydim.

Salt effects on adsorbed nonelectrolytes

1977 ◽  
Vol 55 (23) ◽  
pp. 4018-4027 ◽  
Author(s):  
Robert Aveyard ◽  
Syed M. Saleem
Keyword(s):  
Aqueous Solution ◽  
Surface Effect ◽  
Hydrophobic Interactions ◽  
Tetrabutylammonium Bromide ◽  
Inorganic Salts ◽  
Salt Effects ◽  
Salting Out ◽  
Oh Groups ◽  
Solution Interface ◽  
Alkyl Groups

An approach to the study of the influence of electrolytes on adsorbed nonelectrolytes at liquid surfaces is described. The adsorption of tetrabutylammonium bromide (Bu4NBr) from aqueous solution to the interfaces with octane, decanol, and air has been determined. Results are presented for the effects of some inorganic salts (NaCl, NH4Br, and Na2CO3), and of Bu4NBr on monolayers of butanol at the air – aqueous solution interface, and of Bu4NBr on dodecanol adsorbed at the octane – aqueous solution interface. The interfacial salt effects differ from the bulk effects in the cases studied. The inorganic salts, which salt-out butanol (and alkanols generally) in aqueous solution, have little or no effect on adsorbed butanol. On the other hand, Bu4NBr which salts-in alkanols in bulk aqueous solution has a strong salting-out effect on dodecanol at the liquid–liquid interface; a similar but less marked effect is observed for butanol at the liquid–vapour surface. Salting-in of alkanols by Bu4NBr in bulk has previously been ascribed to hydrophobic interactions between cations and alkyl groups of the alkanol, whereas the surface effect is assumed to result from interactions between alcoholic OH groups and cations.

The kinetics of protein salting-out: Precipitation of yeast enzymes by ammonium sulfate

1976 ◽  
Vol 18 (10) ◽  
pp. 1496-1496 ◽  
Author(s):  
P. R. Foster ◽  
P. Dunnill ◽  
M. D. Lilly
Keyword(s):  
Ammonium Sulfate ◽  
Salting Out ◽  
Kinetics Of
Sign in / Sign up

Export Citation Format

Share Document