scholarly journals Pengabdian Terhadap Masyarakat Pada Balita Menderita ISPA Menggunakan Terapi Komplementer Fisiotrapi Dada

2021 ◽  
Vol 4 (2) ◽  
pp. 464-469
Author(s):  
Linawati Novikasari ◽  
Imam Safaat ◽  
Prima Dian Furqoni
Keyword(s):  
Nursing Care ◽  
Respiratory Infections ◽  
Complementary Therapy ◽  
Acute Illness ◽  
Chest Physiotherapy ◽  
Hot Water ◽  
Eucalyptus Oil ◽  
Water Cover ◽  
Objective Description ◽  
The Way

ABSTRAK Infeksi pernafasan merupakan penyakit akut yang paling banyak terjadi pada anak-anak. Tujuan Deskripsi hasil Asuhan Keperawatan Komprehenshif Pada Balita Dengan Masalah Keperawatan Gangguan Bersih Jalan Nafas (Ispa) MenggunakanTerapi Komplementer menggunakan fisiotrapydadadidesabanjitkecamatanbanjitkabupatenwaykananTahun 2020 Metode yang di lakukan dengan Intervensi Fisioterapi dada yang di lakukan adalah Mengatur posisi pasien (tengkurap di pangkuan) dengan wajah menghadap ke baskom yang berisi air panas. Menutup kepala pasien dengan handuk kecil agar aroma minya kayu putih dapat terhidup dengan benar. Lakukan clapping dengan cara tangan perawat menepuk punggung secarabergantian.Lakukanperkusiselama1-2menit.Lakukanvibrasipada punggung pasien saat dahak keluar, Pada anak -anak, cukup 3 sampai 5 menit.Lakukansekitar4-5kali.kemudianbersihkanareamulutdanhidung pasien dengan tissue. Berikan minyak kayu putih pada punggung dan telapakkakipasien.HasilFisioterapidadayangdilakukanpadakeduaanak di dapatkan hasil yang dapat mengurangi lendir dijalan nafas. Sehingga keduaanakmerasakanlebihlegasertadapattidurlebihtenang.Dari3hari pelaksanaankeduaanakdalamintervensididapatkanhasilyangsamayakni pengeluaran dan perubahan membaik pada hari pertama, hal ini di karenakan usia anak tidak jauh berbeda, kemudian pelaksanaan diikuti anak denganbaik. Kata Kunci: Balita, ISPA, Terapi  ABSTRACT Respiratory infections are the most common acute illness in children. Objective Description of the results of comprehensive nursing care in toddlers with nursing problems Clean Airway Disorders (Ispa) Using Complementary Therapy using chest physiotherapy in the banjit village banjit sub-district of Waykanan in 2020 Methods to be performed with the Intervention of Chest Physiotherapy that is done is to regulate the position of the patient (prone in the chest) in the banjit village lap) with face facing the basin filled with hot water. Cover the patient's head with a small towel so that the scent of eucalyptus can be alive properly. Clapping the nurse's hands alternately patting her back. Perform percussion for 1-2 minutes. Perform vibrations on the patient's back when sputum is out, in children, just 3 to 5 minutes. Do it about 4- 5 times. then clean the patient's mouth and nose area with tissue. Apply eucalyptus oil to the patient's back and feet. Results Chest physiotherapy done on the two children get results that can reduce mucus on the way of breath. So that both children feel more relievedandcansleepmorequietly.From3daystheimplementationofthe two children in the intervention obtained the same results namely expenditure and changes improved on the first day, this is because the age of the child was not much different, then the implementation was followed by the child well. Keywords: Toddlers, ISPA, Therapy

scholarly journals Which triggers could support timely identification of primary antibody deficiency? A qualitative study using the patient perspective

2021 ◽  
Vol 16 (1) ◽  
Author(s):  
Lisanne M. A. Janssen ◽  
Kim van den Akker ◽  
Mohamed A. Boussihmad ◽  
Esther de Vries
Keyword(s):  
Respiratory Infections ◽  
Diagnostic Delay ◽  
Signs And Symptoms ◽  
Negative Influence ◽  
Primary Antibody ◽  
Emotional Impact ◽  
Structured Interviews ◽  
Timely Treatment ◽  
The Way

Abstract Background Patients with predominantly (primary) antibody deficiencies (PADs) commonly develop recurrent respiratory infections which can lead to bronchiectasis, long-term morbidity and increased mortality. Recognizing symptoms and making a diagnosis is vital to enable timely treatment. Studies on disease presentation have mainly been conducted using medical files rather than direct contact with PAD patients. Our study aims to analyze how patients appraised their symptoms and which factors were involved in a decision to seek medical care. Methods 14 PAD-patients (11 women; median 44, range 16-68 years) were analyzed using semi-structured interviews until saturation of key emergent themes was achieved. Results Being always ill featured in all participant stories. Often from childhood onwards periods of illness were felt to be too numerous, too bad, too long-lasting, or antibiotics were always needed to get better. Recurrent or persistent respiratory infections were the main triggers for patients to seek care. All participants developed an extreme fatigue, described as a feeling of physical and mental exhaustion and thus an extreme burden on daily life that was not solved by taking rest. Despite this, participants tended to normalize their symptoms and carry on with usual activities. Non-immunologists, as well as patients, misattributed the presenting signs and symptoms to common, self-limiting illnesses or other ‘innocent’ explanations. Participants in a way understood the long diagnostic delay. They know that the disease is rare and that doctors have to cover a broad medical area. But they were more critical about the way the doctors communicate with them. They feel that doctors often don’t listen very well to their patients. The participants’ symptoms as well as the interpretation of these symptoms by their social environment and doctors had a major emotional impact on the participants and a negative influence on their future perspectives. Conclusions To timely identify PAD, ‘pattern recognition’ should not only focus on the medical ‘red flags’, but also on less differentiating symptoms, such as ‘being always ill’ and ‘worn out’ and the way patients cope with these problems. And, most important, making time to really listen to the patient remains the key.

Concepts and Principles of Integrative Nursing

2018 ◽  
pp. 3-19
Author(s):  
Mary Koithan
Keyword(s):  
Nursing Care ◽  
Nursing Practice ◽  
Care Delivery ◽  
Full Range ◽  
Therapeutic Strategies ◽  
Health And Wellbeing ◽  
Whole Person ◽  
Healing Relationships ◽  
Whole Systems ◽  
The Way

The discipline of nursing has always had a holistic ontology and epistemology that aligns with the unitary paradigm. Yet nursing practice has not always been consistent with these perspectives. This chapter describes concepts and principles of integrative nursing, which offer a way of being-knowing-doing that advances the health and wellbeing of persons, families, and communities through caring/healing relationships in a manner that honors historical roots and transforms nursing care delivery. Six principles provide a framework that can shape the way nurses use evidence to select therapeutic strategies from the full range of possible interventions to support whole person/whole systems healing.

‘Seminar may pave the way for free nursing care

2000 ◽  
Vol 14 (27) ◽  
pp. 7-7
Author(s):  
Pat Healy
Keyword(s):  
Nursing Care ◽  
The Way

Care as A Moral Attitude in Nursing

1999 ◽  
Vol 6 (3) ◽  
pp. 214-223 ◽  
Author(s):  
Chris Gastmans
Keyword(s):  
Nursing Care ◽  
Nursing Profession ◽  
Normative Concept ◽  
Moral Attitude ◽  
The Way

The concept of care can be explained in various ways, and it can present a different meaning to each person. Nurses are increasingly aware that good nursing care consists of ‘more’ than the competent performance of a number of caring activities. For many nurses it is less clear what this ‘more’ means and what importance it has in nursing. This article will develop a view concerning care considered as a moral attitude. It is argued that care can be considered as a foundational normative concept in the ethics of the nursing profession. The aim is to clarify that nurses do not derive their specific caring identity just from the set of tasks that they perform but also from the way in which they commit themselves to the caring process.

scholarly journals Ways to heat hot water via the heat pipes

2018 ◽  
Vol 168 ◽  
pp. 09003
Author(s):  
Peter Hrabovský ◽  
Zuzana Kolková ◽  
Jozef Matušov ◽  
Patrik Nemec
Keyword(s):  
Heat Transfer ◽  
Heat Pipe ◽  
Nuclear Power ◽  
Heat Pipes ◽  
Hot Water ◽  
Temperature Range ◽  
Thermal Output ◽  
Actual Use ◽  
Mechanical Elements ◽  
The Way

The article deals various ways of heating hot water where heat is transferred by the basic phenomena of heat transfer theories, which take place on an innovative basis with the advantage of the absence of mechanical elements. The heat transfer in this case ensures a change in the phase-in phase of the working substance – the fluid – from which the thermal output and the efficiency of the device are derived. The devices described in this article work on the same principle of heat transfer. Each device is characterized by own construction and the principle of heat transfer. Heat pipes are classified according to the way of operation and the place of use. Subdivision of the heat pipe, in terms of its actual, use in the desired temperature range. At present, heating plants use cooling technologies (nuclear power, space stations, IT).

scholarly journals Innovation in Nursing Practices

2016 ◽  
pp. 170-174
Author(s):  
Dilek Kara
Keyword(s):  
Quality Of Life ◽  
Nursing Care ◽  
Chronic Treatment ◽  
Nursing Practice ◽  
Health Sector ◽  
Acute Illness ◽  
Key Factors ◽  
Innovative Strategies ◽  
Quality Of Nursing

Abstract Nowadays the importance of scientific knowledge has been increasing and healt-care applications are changing rapidly. The increasingly aging population, chronic treatment of acute illness depending on which treatment applications have changed the perspective on the quality of the patient's care and maintenance. Innovation is the most important tool for improving the community's quality of life. Usually, the concept of innovation in the health sector and in particular for nursing, new approaches, technologies and ways of working is described as a process of development. Innovatio is vital for improving the quality of nursing care and it’s sustainability. The planning of nursing practice, submission and evaluation of the use of innovative strategies are among the key factors that directly affect the quality of the service. Based on all of these reasons and in the light of the literature, this compilation is prepared to offer information of innovation in nursing practice. Keywords: innovation, examples of innovation, nursing.

Sign in / Sign up

Export Citation Format

Share Document