scholarly journals Finding the way through the respiratory symptoms jungle: PAL can help: Respiratory Infections Assembly contribution to the celebration of 20 years of the ERS

2010 ◽  
Vol 36 (5) ◽  
pp. 979-982 ◽  
Author(s):  
M. van den Boom ◽  
A. Seita ◽  
S. Ottmani ◽  
G. B. Migliori
Keyword(s):  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
The Way

scholarly journals Which triggers could support timely identification of primary antibody deficiency? A qualitative study using the patient perspective

2021 ◽  
Vol 16 (1) ◽  
Author(s):  
Lisanne M. A. Janssen ◽  
Kim van den Akker ◽  
Mohamed A. Boussihmad ◽  
Esther de Vries
Keyword(s):  
Respiratory Infections ◽  
Diagnostic Delay ◽  
Signs And Symptoms ◽  
Negative Influence ◽  
Primary Antibody ◽  
Emotional Impact ◽  
Structured Interviews ◽  
Timely Treatment ◽  
The Way

Abstract Background Patients with predominantly (primary) antibody deficiencies (PADs) commonly develop recurrent respiratory infections which can lead to bronchiectasis, long-term morbidity and increased mortality. Recognizing symptoms and making a diagnosis is vital to enable timely treatment. Studies on disease presentation have mainly been conducted using medical files rather than direct contact with PAD patients. Our study aims to analyze how patients appraised their symptoms and which factors were involved in a decision to seek medical care. Methods 14 PAD-patients (11 women; median 44, range 16-68 years) were analyzed using semi-structured interviews until saturation of key emergent themes was achieved. Results Being always ill featured in all participant stories. Often from childhood onwards periods of illness were felt to be too numerous, too bad, too long-lasting, or antibiotics were always needed to get better. Recurrent or persistent respiratory infections were the main triggers for patients to seek care. All participants developed an extreme fatigue, described as a feeling of physical and mental exhaustion and thus an extreme burden on daily life that was not solved by taking rest. Despite this, participants tended to normalize their symptoms and carry on with usual activities. Non-immunologists, as well as patients, misattributed the presenting signs and symptoms to common, self-limiting illnesses or other ‘innocent’ explanations. Participants in a way understood the long diagnostic delay. They know that the disease is rare and that doctors have to cover a broad medical area. But they were more critical about the way the doctors communicate with them. They feel that doctors often don’t listen very well to their patients. The participants’ symptoms as well as the interpretation of these symptoms by their social environment and doctors had a major emotional impact on the participants and a negative influence on their future perspectives. Conclusions To timely identify PAD, ‘pattern recognition’ should not only focus on the medical ‘red flags’, but also on less differentiating symptoms, such as ‘being always ill’ and ‘worn out’ and the way patients cope with these problems. And, most important, making time to really listen to the patient remains the key.

Understanding the use of pulse oximetry in COVID-19 disease

2021 ◽  
Vol 32 (8) ◽  
pp. 312-316
Author(s):  
Paul Silverston
Keyword(s):  
Oxygen Saturation ◽  
Pulse Oximetry ◽  
Respiratory Symptoms ◽  
Disease Process ◽  
Clinical Findings ◽  
The Other ◽  
Know How ◽  
Non Invasive ◽  
Pulse Oximeters ◽  
The Way

The pandemic has led to an increase in the use of pulse oximetry to assess and manage patients with COVID-19 disease. Paul Silverston explains the principles of pulse oximetry and the factors that can affect the reliability and accuracy of readings Pulse oximetry is performed to detect and quantify the degree of hypoxia in patients with respiratory symptoms and illnesses, including patients with COVID-19 disease. Pulse oximeters are non-invasive, simple to use and inexpensive, but it is important to know how to interpret the readings in the context of the patient's symptoms and the other clinical findings. In COVID-19 disease, very small differences in the oxygen saturation reading result in significant differences in the way that the patient is managed, so it is important to be aware of the factors that can affect these readings. It is also important to appreciate that a low reading in a patient with suspected or confirmed COVID-19 disease may be the result of another disease process.

scholarly journals A 12-month follow-up of an influenza vaccination campaign based on voluntary adherence: report on upper-respiratory symptoms among volunteers and non-volunteers

2001 ◽  
Vol 119 (4) ◽  
pp. 142-145 ◽  
Author(s):  
Páris Ali Ramadan ◽  
Francisco Barreto de Araújo ◽  
Mario Ferreira Junior
Keyword(s):  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
Vaccination Campaign ◽  
Influenza Like Illness ◽  
Upper Respiratory Infections ◽  
Medical Consultations ◽  
History Of ◽  
Upper Respiratory ◽  
Upper Respiratory Symptoms

CONTEXT: Routine immunization of groups at high risk for influenza has been progressively implemented as a matter of Brazilian public health policy. Although the benefits of the vaccination for healthy young adults are still controversial, it has been offered yearly to hundreds of thousands of Brazilian workers, generally as part of wellness initiatives in the workplace. OBJECTIVE: To study the characteristics of subjects that accepted or refused to be vaccinated against influenza and to report on respiratory symptoms in both groups, one year after the campaign date. DESIGN: A prospective observational study. SETTING: Workers at a subsidiary of an international bank in São Paulo, Brazil. PARTICIPANTS: 124 persons that did not accept and 145 that voluntarily accepted the vaccine completed 12 months of follow-up. MAIN MEASUREMENTS: Data concerning gender, age, tobacco use, and any history of chronic respiratory illness such as asthma, bronchitis, rhinitis, and repetitive upper-respiratory infections, were recorded at the time of vaccination. After that, workers were asked monthly by questionnaire or telephone about respiratory symptoms, days of work lost and medical consultations. RESULTS: The results showed statistically significant differences regarding age (P = 0.004) with the vaccinated group (V) being younger than the non-vaccinated (NV) one, and with reference to previous repetitive upper-respiratory infections being higher among the V group (P < 0.0001). During the follow-up, the V group reported more occurrences of upper respiratory symptoms (P < 0.0001), due to both non-influenza (P < 0.0001) and influenza-like illness (P = 0.045). Differences were also found between V and NV groups concerning days off work and number of medical consultations due to upper-respiratory symptoms and non-influenza illness. Gender and history of repetitive upper-respiratory infections were the best predictors of influenza-like illness-related events. CONCLUSIONS: The making of previous reference to repetitive upper-respiratory infections was a major difference between those who accepted or rejected the vaccine. The vaccination itself was not sufficient to reduce the number of occurrences of respiratory symptoms and related absenteeism to levels similar to those found among non-vaccinated people.

The Use of Children's Medical Records to Predict the Risk of Asthma Attack

1995 ◽  
Vol 40 (5) ◽  
pp. 138-140 ◽  
Author(s):  
R.G. Neville ◽  
F.P. Bryce ◽  
R.A. Clark ◽  
I K Crombie
Keyword(s):  
Childhood Asthma ◽  
Medical Records ◽  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
Large Data ◽  
Respiratory Morbidity ◽  
Asthma Attack ◽  
One Year ◽  
Subsequent Risk

Using a large data base of respiratory morbidity in children the opportunity arose to explore the link between what was written in general practice case records and the subsequent risk of a child developing an asthma attack or hospital admission due to asthma. Children with five or more consultations in one year for respiratory symptoms had a 33% risk of experiencing an asthma attack or 7.1% risk of admission in the following year. Twenty seven percent of children who received antibiotics for “respiratory infections” subsequently had an asthma attack. The potential exists to review past and present symptoms and thus attempt to predict future morbidity. Childhood asthma is an example where the quality of care offered by general practitioners could be improved if a precise estimate of risk could be used to modify clinical management.

scholarly journals Respiratory Health in Adults Residing Near a Coal-Burning Power Plant with Coal Ash Storage Facilities: A Cross-Sectional Epidemiological Study

2019 ◽  
Vol 16 (19) ◽  
pp. 3642 ◽  
Author(s):  
Abby N. Hagemeyer ◽  
Clara G. Sears ◽  
Kristina M. Zierold
Keyword(s):  
Epidemiological Study ◽  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
Respiratory Health ◽  
Coal Ash ◽  
Health Impact ◽  
P Value ◽  
Cross Sectional ◽  
Exposed Population ◽  
Burning Coal

Coal ash, the byproduct of burning coal made up of small particles, including heavy metals and radioactive elements, is discarded in open-air landfills where it can be emitted into the air, contributing to air pollution in the surrounding community. Few regulations exist regarding the storage, disposal, and transport of coal ash. There is limited research on the health impacts of coal ash exposure on communities. The purpose of this study was to examine the prevalence of respiratory symptoms among adults exposed to coal ash and non-exposed adults. A cross-sectional epidemiological study was conducted among two populations: one exposed to coal ash and one not exposed to coal ash. Perception of health (p-Value < 0.0001), cough (Adjusted Odds Ratio (AOR) = 5.30, 95% Confidence Intervals (CI) = 2.60–11), shortness of breath (AOR = 2.59, 95% CI = 1.56–4.31), hoarseness (AOR = 4.02, 95% CI = 2.45–6.60), respiratory infections (AOR = 1.82, 95% CI = 1.14–2.89), and mean overall respiratory health score (p-Value < 0.0001) were all statistically significantly greater in exposed adults (N = 231) when compared to non-exposed adults (N = 170). Adults residing near the coal ash facility were more likely to report respiratory symptoms than the non-exposed population. More research on the health impact of coal ash and storage regulations needs to be conducted.

scholarly journals Prevalence of gastroenteritis among 4-year-old children in South Australia

2003 ◽  
Vol 130 (3) ◽  
pp. 443-451 ◽  
Author(s):  
J. S. HEYWORTH ◽  
P. BAGHURST ◽  
K. A. McCAUL
Keyword(s):  
Risk Factors ◽  
Respiratory Symptoms ◽  
School Health ◽  
Respiratory Infections ◽  
Gastrointestinal Symptoms ◽  
South Australia ◽  
Antibiotic Use ◽  
Medical Attention ◽  
Cross Sectional Survey ◽  
Cross Sectional

The aim of this study was to determine the prevalence of gastroenteritis among children aged 4 years in South Australia. A cross-sectional survey of 9543 South Australian children aged 4 years was undertaken. Parents completed a questionnaire on behalf of their child who had attended a pre-school health check in 1998. The questionnaire covered gastrointestinal and respiratory symptoms experienced by the child in the previous 2 weeks and other risk factors for gastroenteritis. The 2-week prevalence of gastroenteritis among 4-year-old children was 14·2%. The major risk factors for gastroenteritis were presence of persons who had gastroenteritis inside the home, contact with persons who had gastroenteritis outside the home, antibiotic use and sore throat. Medical attention was sought for 20% of children who had gastroenteritis. Gastroenteritis is a significant cause of morbidity among young children and presents a considerable burden on the community. A substantial proportion of these occurrences of highly credible gastrointestinal symptoms may be manifestations of respiratory infections.

scholarly journals Associations of Adenovirus Genotypes in Korean Acute Gastroenteritis Patients with Respiratory Symptoms and Intussusception

2017 ◽  
Vol 2017 ◽  
pp. 1-6 ◽  
Author(s):  
Jae-Seok Kim ◽  
Su Kyung Lee ◽  
Dae-Hyun Ko ◽  
Jungwon Hyun ◽  
Han-Sung Kim ◽  
...  
Keyword(s):  
Acute Gastroenteritis ◽  
Respiratory Symptoms ◽  
Clinical Symptoms ◽  
Respiratory Infections ◽  
Hexon Gene ◽  
Prevention Strategies ◽  
Treatment And Prevention ◽  
Clinical Laboratories ◽  
Wide Range ◽  
Positive Results

Human adenoviruses (HAdVs) cause a wide range of diseases, including respiratory infections and gastroenteritis, and have more than 65 genotypes. To investigate the current genotypes of circulating HAdV strains, we performed molecular genotyping of HAdVs in the stool from patients with acute gastroenteritis and tried to determine their associations with clinical symptoms. From June 2014 to May 2016, 3,901 fecal samples were tested for an AdV antigen, and 254 samples (6.5%) yielded positive results. Genotyping using PCR and sequencing of the capsid hexon gene was performed for 236 AdV antigen-positive fecal specimens. HAdV-41, of species F, was the most prevalent genotype (60.6%), followed by HAdV-2 of species C (13.8%). Other genotypes, including HAdV-3, HAdV-1, HAdV-5, HAdV-6, HAdV-31, HAdV-40, HAdV-12, and HAdV-55, were also detected. Overall, 119 patients (50.4%) showed concomitant respiratory symptoms, and 32 patients (13.6%) were diagnosed with intussusception. HAdV-1 and HAdV-31 were significantly associated with intussusception (P<0.05). Our results demonstrate the recent changes in trends of circulating AdV genotypes associated with gastroenteritis in Korea, which should be of value for improving the diagnosis and developing new detection, treatment, and prevention strategies for broad application in clinical laboratories.

scholarly journals Pengabdian Terhadap Masyarakat Pada Balita Menderita ISPA Menggunakan Terapi Komplementer Fisiotrapi Dada

2021 ◽  
Vol 4 (2) ◽  
pp. 464-469
Author(s):  
Linawati Novikasari ◽  
Imam Safaat ◽  
Prima Dian Furqoni
Keyword(s):  
Nursing Care ◽  
Respiratory Infections ◽  
Complementary Therapy ◽  
Acute Illness ◽  
Chest Physiotherapy ◽  
Hot Water ◽  
Eucalyptus Oil ◽  
Water Cover ◽  
Objective Description ◽  
The Way

ABSTRAK Infeksi pernafasan merupakan penyakit akut yang paling banyak terjadi pada anak-anak. Tujuan Deskripsi hasil Asuhan Keperawatan Komprehenshif Pada Balita Dengan Masalah Keperawatan Gangguan Bersih Jalan Nafas (Ispa) MenggunakanTerapi Komplementer menggunakan fisiotrapydadadidesabanjitkecamatanbanjitkabupatenwaykananTahun 2020 Metode yang di lakukan dengan Intervensi Fisioterapi dada yang di lakukan adalah Mengatur posisi pasien (tengkurap di pangkuan) dengan wajah menghadap ke baskom yang berisi air panas. Menutup kepala pasien dengan handuk kecil agar aroma minya kayu putih dapat terhidup dengan benar. Lakukan clapping dengan cara tangan perawat menepuk punggung secarabergantian.Lakukanperkusiselama1-2menit.Lakukanvibrasipada punggung pasien saat dahak keluar, Pada anak -anak, cukup 3 sampai 5 menit.Lakukansekitar4-5kali.kemudianbersihkanareamulutdanhidung pasien dengan tissue. Berikan minyak kayu putih pada punggung dan telapakkakipasien.HasilFisioterapidadayangdilakukanpadakeduaanak di dapatkan hasil yang dapat mengurangi lendir dijalan nafas. Sehingga keduaanakmerasakanlebihlegasertadapattidurlebihtenang.Dari3hari pelaksanaankeduaanakdalamintervensididapatkanhasilyangsamayakni pengeluaran dan perubahan membaik pada hari pertama, hal ini di karenakan usia anak tidak jauh berbeda, kemudian pelaksanaan diikuti anak denganbaik. Kata Kunci: Balita, ISPA, Terapi  ABSTRACT Respiratory infections are the most common acute illness in children. Objective Description of the results of comprehensive nursing care in toddlers with nursing problems Clean Airway Disorders (Ispa) Using Complementary Therapy using chest physiotherapy in the banjit village banjit sub-district of Waykanan in 2020 Methods to be performed with the Intervention of Chest Physiotherapy that is done is to regulate the position of the patient (prone in the chest) in the banjit village lap) with face facing the basin filled with hot water. Cover the patient's head with a small towel so that the scent of eucalyptus can be alive properly. Clapping the nurse's hands alternately patting her back. Perform percussion for 1-2 minutes. Perform vibrations on the patient's back when sputum is out, in children, just 3 to 5 minutes. Do it about 4- 5 times. then clean the patient's mouth and nose area with tissue. Apply eucalyptus oil to the patient's back and feet. Results Chest physiotherapy done on the two children get results that can reduce mucus on the way of breath. So that both children feel more relievedandcansleepmorequietly.From3daystheimplementationofthe two children in the intervention obtained the same results namely expenditure and changes improved on the first day, this is because the age of the child was not much different, then the implementation was followed by the child well. Keywords: Toddlers, ISPA, Therapy

scholarly journals Outpatient Management of Oligosymptomatic Patients with Respiratory Infection in the Era of SARS-CoV-2. Experience from Rural German General Practitioners 

2020 ◽  
Author(s):  
Simon Wernhart ◽  
Tim Henning Förster ◽  
Eberhard Weihe
Keyword(s):  
Sore Throat ◽  
Health Risks ◽  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
Physical Contact ◽  
Screening Methods ◽  
Outpatient Management ◽  
Robert Koch Institute ◽  
Multicenter Studies ◽  
Test Strategy

Abstract Background: Covid-19 is causing a pandemic and forces physicians to restructure their daily work. We want to share our experience in the outpatient management of potentially infected patients with colleagues from other countries with special consideration of altered national test strategies during the crisis.Methods: We analysed all patients with respiratory symptoms reporting to our three rural general practioner (GP) offices in North Rhine Westphalia, Germany, from 27.01-20.04.2020 (n=489 from a total of 6090 patients). Patients with respiratory symptoms were examined in a separated isolation area, while the others were allowed to enter the office. We applied the first recommended algorithm of the German Robert Koch Institute (RKI) to test suspected patients and compared our results to an adapted, more liberal version of the RKI, which is currently applied in Germany.Results: Eighty patients (16.36%, mean age: 47.03years+-18.08) were sent to a nasopharyngeal smear. five patients (6.25%) turned out to be positive, four of which had established risk factors for COVID-19. Overall, the most common symptoms were cough (83.75%), sore throat (71.25%), as well as myalgia and fatigue (66.25%). The most common diagnoses were rhinopharyngitis (37.22%) and acute bronchitis (30.27%). A sore throat was more common in positively tested patients (80% vs. 12%). Applying the first RKI test strategy yielded 6.25% of positive tests (n=80), while the more liberal later RKI recommendation would have achieved 1.36% of positive tests from 369 patients. No positive test was missed by applying the conservative strategy. None of our employees called in sick during this period, which emphasizes the efficacy and safety of our screening methods. Conclusion: A clinical distinction between ordinary respiratory infections and COVID-19 is not possible in a low-prevalence population. Our model to prevent unprotected physical contact, screen patients in front of the office with protective equipment, and to examine respiratory infections in separated areas works in the GP setting without overt health risks for employees. Thus, this approach should be used as a GP standard to uphold patient care without major health risks for the personnel. Large multicenter studies are necessary to work out the most suitable test strategy.

Follow-up of Acute Respiratory Disorders in Cyclists Competing in the 100th Giro d’Italia

2020 ◽  
Author(s):  
Luca Pollastri ◽  
Claudio Macaluso ◽  
Giovanni Vinetti ◽  
Giovanni Tredici ◽  
Francesca Lanfranconi
Keyword(s):  
Nitric Oxide ◽  
Respiratory Symptoms ◽  
Respiratory Infections ◽  
Clinical History ◽  
Exhaled Nitric Oxide ◽  
Respiratory Disorder ◽  
Non Invasive ◽  
Respiratory Inflammation ◽  
Elite Cyclists

AbstractAcute respiratory disorder is a common sub-clinical condition affecting elite cyclists. Monitoring the perturbations of the immunological cells in the respiratory tract, indicative of a likely proinflammatory state, during an International Cycling Union world tour is a challenging task. The aim of this study was to follow up on the sign and symptoms of upper way respiratory infections with or without asthma, using non-invasive methods, during a 21-day race (100° Giro d’Italia, 2017). Nine male elite cyclists of the Bahrain Merida Team were evaluated before the training season and daily during the race. Clinical history, skin prick and spirometric test, acute respiratory symptoms were measured using validated questionnaires, and values of fraction of exhaled nitric oxide were collected longitudinally. Four of the 9 athletes had allergies with/or consistent abnormal spirometric curves before the race. During the race, 5 athletes had a fraction of exhaled nitric oxide values >20 ppb which correlated with respiratory symptoms collected through questionnaires. These were related to the environmental characteristics of the places travelled through in the race. The athletes with a predisposition to chronic respiratory inflammation in the pre-competitive season were more likely to develop acute respiratory symptoms during the race

Sign in / Sign up

Export Citation Format

Share Document