Applications of the US EPA CompTox Chemicals Dashboard to support mass spectrometry and breath research

2020 ◽  
pp. 649-661
Author(s):  
Antony J. Williams ◽  
Jon R. Sobus
Keyword(s):  
Mass Spectrometry ◽  
The Us ◽  
Us Epa

Fundamental Characterisation of Dredged Marine Sediments from Kuala Perlis Jetty by XRF, XRD and FTIR

2012 ◽  
Vol 620 ◽  
pp. 469-473 ◽  
Author(s):  
Norhashimah Ramli ◽  
Mohammad Hafizuddin Haji Jumali ◽  
Wan Safizah Wan Salim
Keyword(s):  
Heavy Metals ◽  
Marine Sediments ◽  
Xrd Analysis ◽  
Raw Material ◽  
Ftir Analysis ◽  
Huge Amount ◽  
The Us ◽  
Dredged Marine Sediment ◽  
Primary Mineral ◽  
Us Epa

Dredging along Kuala Perlis Jetty results in huge amount of marine sediments which has thrown considerable challenge for disposal. This research was conducted to characterize dredged marine sediment which was collected at Kuala Perlis Jetty as potential raw material for brick production. Three different characterizations were performed namely XRF, XRD and FTIR. XRF analysis showed the presence of SiO2 and Al2O3 as major quantities. Low concentration of heavy metals namely As, Cr, Cu, Pb, Ni and Zn presence in the sediment comply the US EPA guideline for brick production. XRD analysis indicated the presence of quartz as primary mineral while kaolinite and illite also present as secondary and ternary phases. FTIR analysis identified various form of minerals presence in the samples which strongly supported XRD results.

scholarly journals Indoor thermal factors and symptoms in office workers: findings from the US EPA BASE study

Indoor Air ◽  
2009 ◽  
Vol 19 (4) ◽  
pp. 291-302 ◽  
Author(s):  
M. J. Mendell ◽  
A. G. Mirer
Keyword(s):  
Office Workers ◽  
Base Study ◽  
The Us ◽  
Us Epa

Water reclamation and reuse criteria in the U.S.

1996 ◽  
Vol 33 (10-11) ◽  
pp. 451-462 ◽  
Author(s):  
James Crook ◽  
Rao Y. Surampalli
Keyword(s):  
Surface Waters ◽  
Water Reuse ◽  
Reclaimed Water ◽  
Water Reclamation ◽  
Water Supplies ◽  
The Us ◽  
Attractive Option ◽  
Us Epa ◽  
The Individual ◽  
The U.S

Increasing demands on water resources for domestic, commercial, industrial, and agricultural purposes have made water reclamation and reuse an attractive option for conserving and extending available water supplies. Also, many water reuse projects are implemented to eliminate a source of contamination in surface waters or as a least-cost alternative to meeting stringent discharge requirements. Reclaimed water applications range from pasture irrigation to augmentation of potable water supplies. Water reclamation and reuse criteria are principally directed at health protection. There are no federal regulations governing water reuse in the U.S.; hence, the regulatory burden rests with the individual states. This has resulted in differing standards among states that have developed criteria. This paper summarizes and compares the criteria from some states that have developed comprehensive regulations. Guidelines published by the US. EPA and the rationale behind them are presented for numerous types of reclaimed water applications.

scholarly journals Simulation of a biogas cleaning process using different amines

2018 ◽  
Vol 27 (47) ◽  
Author(s):  
Guillermo Sepúlveda ◽  
Luis Eduardo Jaimes ◽  
Leonardo Pacheco ◽  
Carlos Alirio Díaz
Keyword(s):  
Environmental Protection Agency ◽  
Landfill Gas ◽  
Cleaning Process ◽  
Fuel Gas ◽  
Combustion Properties ◽  
The Us ◽  
Us Epa ◽  
Combustible Gases ◽  
Combustion Processes ◽  
Landfill Gas Emissions

The use of biogas generated in landfills has gained importance in developing countries like Colombia. Taking into account that this biogas presents poor combustion properties that make interchangeability with other combustible gases difficult, the elimination of gases and vapors, such as CO2 and H2O, through a cleaning process, in which the biogas is converted to biomethane, improves the biogas properties as a fuel gas for general use. In this work, we simulated the generation of biogas at El Carrasco sanitary landfill in Bucaramanga, using the US EPA (United States Environmental Protection Agency) landfill gas emissions model. Additionally, we simulated the biogas cleaning process to extract the remaining moisture using the ProMax software; for this, we used three different amines (MDEA, MEA, and DEA), followed by a glycol dehydration process. The results showed that the amine MEA produced the largest increase in the concentration of CH4 (90.37 %) for the biogas generated in the landfill. Furthermore, dehydration with glycol was an efficient process to obtain a gas with a high percentage of methane (91.47 %) and low water presence (1.27 %); this would allow the use of biomethane in conventional industrial combustion processes and power generation.

scholarly journals National Academy of Clinical Biochemistry Laboratory Medicine Practice Guidelines: Follow-Up Testing for Metabolic Disease Identified by Expanded Newborn Screening Using Tandem Mass Spectrometry; Executive Summary

2009 ◽  
Vol 55 (9) ◽  
pp. 1615-1626 ◽  
Author(s):  
Dennis J Dietzen ◽  
Piero Rinaldo ◽  
Ronald J Whitley ◽  
William J Rhead ◽  
W Harry Hannon ◽  
...  
Keyword(s):  
Mass Spectrometry ◽  
Amino Acids ◽  
Tandem Mass Spectrometry ◽  
Organic Acids ◽  
Newborn Screening ◽  
Tandem Mass ◽  
Confirmatory Testing ◽  
The Us ◽  
The Impact

Abstract Background: Almost all newborns in the US are screened at birth for multiple inborn errors of metabolism using tandem mass spectrometry. Screening tests are designed to be sufficiently sensitive so that cases are not missed. The NACB recognized a need for standard guidelines for laboratory confirmation of a positive newborn screen such that all babies would benefit from equal and optimal follow-up by confirmatory testing. Methods: A committee was formed to review available data pertaining to confirmatory testing. The committee evaluated previously published guidelines, published methodological and clinical studies, clinical case reports, and expert opinion to support optimal confirmatory testing. Grading was based on guidelines adopted from criteria derived from the US Preventive Services Task Force and on the strength of recommendations and the quality of the evidence. Three primary methods of analyte measurement were evaluated for confirmatory testing including measurement of amino acids, organic acids, and carnitine esters. The committee graded the evidence for diagnostic utility of each test for the screened conditions. Results: Ample data and experience were available to make strong recommendations for the practice of analyzing amino acids, organic acids, and acylcarnitines. Likewise, strong recommendations were made for the follow-up test menu for many disorders, particularly those with highest prevalence. Fewer data exist to determine the impact of newborn screening on patient outcomes in all but a few disorders. The guidelines also provide an assessment of developing technology that will fuel a refinement of current practice and ultimate expansion of the diseases detectable by tandem mass spectrometry. Conclusions: Guidelines are provided for optimal follow-up testing for positive newborn screens using tandem mass spectrometry. The committee regards these tests as reliable and currently optimal for follow-up testing. .

scholarly journals Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics

Glycobiology ◽  
2020 ◽  
Author(s):  
Dapeng Zhou ◽  
Xiaoxu Tian ◽  
Ruibing Qi ◽  
Chao Peng ◽  
Wen Zhang
Keyword(s):  
Mass Spectrometry ◽  
Insect Cells ◽  
Mass Spectrometry Analysis ◽  
Native Form ◽  
Spectrometry Analysis ◽  
Peptide Epitopes ◽  
Central Helix ◽  
The Us ◽  
Accessible Surface ◽  
Heptad Repeats

Abstract Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins. The mechanisms by which human antibodies may recognize the antigenic viral peptide epitopes hidden by the sugar coat are unknown. Glycosylation by insect cells differs from the native form produced in human cells, but insect cell-derived influenza vaccines have been approved by the US Food and Drug Administration. In this study, we analyzed recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein secreted from BTI-Tn-5B1-4 insect cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of spike proteins according to cryogenic electron microscopy and homolog-modeled structures and available antibodies that bind to SARS-CoV-1. All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains include those located on central helix, connecting region, heptad repeats and N-terminal domain. Because the majority of antibody paratopes bind to the peptide portion with or without sugar modification, we propose a snake-catching model for predicted paratopes: a minimal length of peptide is first clamped by a paratope and sugar modifications close to the peptide either strengthen or do not hinder the binding.

scholarly journals Geochemical Behavior of Uranium and Radon in Groundwater of Jurassic Granite Area, Icheon, Middle Korea

Water ◽  
2019 ◽  
Vol 11 (6) ◽  
pp. 1278 ◽  
Author(s):  
Byong Wook Cho ◽  
Chang Oh Choo
Keyword(s):  
Standard Deviation ◽  
Environmental Protection Agency ◽  
Maximum Contaminant Level ◽  
Contaminant Level ◽  
Low Concentrations ◽  
Wide Range ◽  
The Us ◽  
Us Epa ◽  
Independent Behavior ◽  
Radon Concentrations

Uranium concentrations (a total of 82 samples) in groundwater in Icheon, middle Korea, showed a wide range from 0.02 to 1640 μg/L with a mean of 56.77 μg/L, a median of 3.03 μg/L, and a standard deviation of 228.63 μg/L. Most groundwater samples had quite low concentrations: 32.9% were below 1 μg/L, while 15.9% exceeded 30 μg/L, the maximum contaminant level (MCL) of the US EPA (Environmental Protection Agency). Radon concentrations also ranged widely from 1.48 to 865.8 Bq/L. Although the standard deviation of radon was large (151.8 Bq/L), the mean was 211.29 Bq/L and the median was 176.86 Bq/L. Overall, 64.6% of the samples exceeded the alternative maximum contaminant level (AMCL) of the US EPA (148 Bq/L). According to statistical analyses, there was no close correlations between uranium and radon, but there were correlations between uranium and redox potential (Eh) (−0.54), dissolved oxygen (DO) (−0.50), HCO3− (0.45), Sr (0.65), and SiO2 (−0.44). Radon showed independent behavior with respect to most components in groundwater. Uranium concentrations in groundwater increased with increasing water–rock interactions. Anomalously high uranium and radon concentrations in groundwater are preferentially localized in granite areas and spatial distributions are remarkably heterogeneous.

Photochemical assessment monitoring stations program adapted for ozone precursors monitoring network in Mexico City

Atmósfera ◽  
2016 ◽  
Vol 29 (2) ◽  
pp. 169 ◽  
Author(s):  
Mónica Del Carmen Jaimes Palomera ◽  
Humberto Bravo Álvarez ◽  
Rodolfo Sosa Echeverria ◽  
Elías Granados Hernández ◽  
Pablo Sánchez Álvarez ◽  
...  
Keyword(s):  
Mexico City ◽  
Atmospheric Chemistry ◽  
Control Strategies ◽  
Monitoring Network ◽  
Ozone Precursors ◽  
The Us ◽  
Us Epa ◽  
Photochemical Modeling ◽  
Urban Ozone ◽  
Monitoring Stations

The purpose of this study is to select a number of stations from the existing Sistema de Monitoreo Atmosférico (Atmospheric Monitoring System, SIMAT) of Mexico City to serve as an equivalent to the Photochemical Assessment Monitoring Stations according to the US-EPA criteria, in order to improve the study of urban ozone occurrence. The results indicate that four existing SIMAT stations meet the criteria to form such network. The relevance of this study is to present an ozone precursors monitoring network with continuous measurements for future trustful studies on air quality for ozone, considering the atmospheric chemistry and photochemical modeling for the design control strategies appropriate for the particular conditions of Mexico City.

Sign in / Sign up

Export Citation Format

Share Document