scholarly journals 189 Prevalence of comorbidities and the incidence of cardiovascular disease in those with non-cardiac chest pain

2021 ◽  
Author(s):  
Sai Ramesh ◽  
Kayleigh Mason ◽  
James Bailey ◽  
Mamas Mamas ◽  
Kelvin Jordan
Keyword(s):  
Cardiovascular Disease ◽  
Chest Pain

scholarly journals Primary care use and cardiovascular disease risk in Russian 40–69 year olds: a cross-sectional study

2020 ◽  
pp. jech-2019-213549
Author(s):  
Jakob Petersen ◽  
Anna Kontsevaya ◽  
Martin McKee ◽  
Erica Richardson ◽  
Sarah Cook ◽  
...  
Keyword(s):  
Cardiovascular Disease ◽  
Primary Care ◽  
Chest Pain ◽  
Russian Federation ◽  
General Health ◽  
Cross Sectional Study ◽  
Health Check ◽  
Sectional Study ◽  
Cvd Risk ◽  
Cross Sectional

BackgroundThe Russian Federation has very high cardiovascular disease (CVD) mortality rates compared with countries of similar economic development. This cross-sectional study compares the characteristics of CVD-free participants with and without recent primary care contact to ascertain their CVD risk and health status.MethodsA total of 2774 participants aged 40–69 years with no self-reported CVD history were selected from a population-based study conducted in Arkhangelsk and Novosibirsk, Russian Federation, 2015–2018. A range of co-variates related to socio-demographics, health and health behaviours were included. Recent primary care contact was defined as seeing primary care doctor in the past year or having attended a general health check under the 2013 Dispansarisation programme.ResultsThe proportion with no recent primary care contact was 32.3% (95% CI 29.7% to 35.0%) in males, 16.3% (95% CI 14.6% to 18.2%) in females, and 23.1% (95% CI 21.6% to 24.7%) overall. In gender-specific age-adjusted analyses, no recent contact was also associated with low education, smoking, very good to excellent self-rated health, no chest pain, CVD 10-year SCORE risk 5+%, absence of hypertension control, absence of hypertension awareness and absence of care-intensive conditions. Among those with no contact: 37% current smokers, 34% with 5+% 10-year CVD risk, 32% untreated hypertension, 20% non-anginal chest pain, 18% problem drinkers, 14% uncontrolled hypertension and 9% Grade 1–2 angina. The proportion without general health check attendance was 54.6%.ConclusionPrimary care and community interventions would be required to proactively reach sections of 40–69 year olds currently not in contact with primary care services to reduce their CVD risk through diagnosis, treatment, lifestyle recommendations and active follow-up.

scholarly journals Clinical value of chest pain presentation and prodromes on the assessment of cardiovascular disease: a cohort study

BMJ Open ◽  
2015 ◽  
Vol 5 (4) ◽  
pp. e007251-e007251 ◽  
Author(s):  
J. Robson ◽  
L. Ayerbe ◽  
R. Mathur ◽  
J. Addo ◽  
A. Wragg
Keyword(s):  
Cardiovascular Disease ◽  
Cohort Study ◽  
Chest Pain ◽  
Clinical Value

scholarly journals AYURVEDIC REVIEW ON DIAGNOSIS AND MANAGEMENT OF HRIDROGA WITH THE SPECIAL REFERENCE TO CARDIOVASCULAR DISEASE

AYUSHDHARA ◽  
2020 ◽  
pp. 2719-2724
Author(s):  
Deepti Sharma ◽  
Udai Raj Saroj ◽  
Abhishek Upadhyay ◽  
Binod Kumar Singh
Keyword(s):  
Cardiovascular Disease ◽  
Heart Disease ◽  
Chest Pain ◽  
Special Reference ◽  
Present Article ◽  
Modern Medicine ◽  
Diagnosis And Treatment ◽  
Diagnosis And Management ◽  
Excessive Intake ◽  
The Many

According to AcharyaSushruta, in the presence of the Etiological factors the dosha get vitiated and provoked all the three Doshas spread out of their place and vitiate the RasaDhatu in the heart. Vitiate Rasa Dhatu (body lymph /chyle) manifestation of various types of pain is being produced, which is called ‘Hridbadha’ or Hridroga. Cardiovascular disease (CVD) is the most important cause of global death, accounting for 17.3 million deaths per year, a number that is expected to grow to more than 23.6 million by 2030. Aim and objectives-Diagnosis and treatment of Hridroga through Ayurveda and its modern correlation.Mode ofAction of Hridyadrugs promoting heart’s health.Improper diet (excessive intake of Kshar, Lavana Rasa, Virudahbhojana) and Vegadharna, Chinta,Krodhaetc. are few among the many causes of Hridroga. In understanding symptomology of cardiovasculardisorder, it should be noted thatVaivarnya (Panduta /Shweta/Shyava) can be correlated to pallor and cyanosis, Murcchato Syncope, Kasato cough with or without Hemoptysis, Shwasato breathlessness or dyspnea, Ruja to Chest pain or discomfort. Drugs used in various formulations in Hridrogahaveproperties like Pachana, Deepana, Hridya, Anulomana,Rasayana and Krimihara.So, in present article an effort has been made to explain the heart disease and its management through Ayurveda as well as modern medicine.

scholarly journals HUMAN HEALTH AND POLLUTION

2015 ◽  
Vol 3 (9SE) ◽  
pp. 1-2
Author(s):  
Chandrakantasaraf
Keyword(s):  
Mental Health ◽  
Cardiovascular Disease ◽  
Chest Pain ◽  
Kidney Disease ◽  
Human Health ◽  
Hydrogen Fluoride ◽  
Well Being ◽  
Good Health ◽  
Spiritual Health ◽  
Social Health

Human health is a state of complete physical, mental and social well-being. Good health also includes physical health, mental health, intellectual health, spiritual health, and social health. A person goes to health when his body is healthy and healthy and calm.Pollution is a kind of disease through age, water, dust, etc. not only in humans' bodies, but also on the animals, animals, animals, trees, animals and animals. Fatigue, cough, throat disease, cardiovascular disease, kidney disease, chest pain etc.Pryavarnkopradusitkrnewaleanekpramuk Praduskhakpraduskvepdarthhajinhenmnushy Bnataha, Upyogkrtahaawrantmen Seshbagkopryavarnmenfenkdetahakpryavarnkopradusitkrnewalapramuk Pdarthjmahuyepdarthjase- smoke, dust, grit, Gradi, Rasyanikpdarthjase-Ditrjents hydrogen fluoride, Fasginadi, Dhatuyenjase-iron, mercury, zinc, Sisaadi, Gasjase-Kaॅrbnmonaॅksaid, Slfrday oxide, ammonia, chlorine, Florinadi , Fertilizers such as urea, potassic etc., pasticides such as DTM herbicides, insecticides etc., aerated sludge, sound heat, radioactive substances. मानवस्वास्थ्य एक पूर्ण शारीरिक, मानसिकऔरसामाजिक खुषहाली की स्थितिहै।अच्छेस्वास्थ्य में शारीरिकस्वास्थ्य, मानसिकस्वास्थ्य, बौद्धिक स्वास्थ्य, आध्यात्मिकस्वास्थ्य औरसामाजिकस्वास्थ्य भी शामिलहै। एक व्यक्तिकोस्वस्थतबकहांजाताहैजबउसका शरीरस्वस्थऔरमनसाफऔर शांतहो।प्रदूषण एक प्रकारकाजहरहैजोवायु, जल, धूलआदि के माध्यम से न केवलमनुष्य के शरीरमेंप्रवेषकरउसे रूग्णबनादेताहैवरन् जीवजन्तुओं, पशुपक्षियों, पेड़पौधेओरवनस्पतियोंकोभीनष्टकरदेताहै।प्रदूषणअनेकभयानकबिमारियोंकोजन्मदेताहै।जैसे-कैंसर, तपेदिक, रक्तचाप, दमा, हैजा, मलेरिया, चर्मरोग, नेत्ररोग, कान के रोग, स्वाइन फ्लू, सिरदर्द, थकान, खांसी, गले की बिमारी, हृदय संबंधीरोग, वृक्करोग, सीनेमेंदर्दआदि।पर्यावरणकोप्रदूषितकरनेवालेअनेकप्रमुख प्रदूषकहै।प्रदूषकवेपदार्थहैजिन्हेंमनुष्य बनाताहै, उपयोगकरताहैऔरअंतमें शेषभागकोपर्यावरणमेंफेंकदेताहै।पर्यावरणकोप्रदूषितकरनेवालाप्रमुख पदार्थजमाहुयेपदार्थजैसे- धुआं, धूल, ग्रिट, घरआदि, रासयानिकपदार्थजैसे-डिटरजेंटस् हाइड्रोजन फ्लोराइड, फास्जीनआदि, धातुयेंजैसे-लोहा, पारा, जिंक, सीसाआदि, गैसजैसे-काॅर्बनमोनाॅक्साइड, सल्फरडाॅय आॅक्साइड, अमोनिया, क्लोरिन, फ्लोरिनआदि, उर्वरकजैसे यूरिया, पोटाषआदि, पेस्टीसाइड्सजैसे-डी.टी.टीकवकनाषी, कीटनाषीआदि, वाहितमलजैसे-गंदापानी, ध्वनिउष्मा, रेडियोंएक्टिवपदार्थहै।

scholarly journals Hasil Klasifikasi Algoritma Backpropagation dan K-Nearest Neighbor pada Cardiovascular Disease

2021 ◽  
Vol 1 (1) ◽  
pp. 17-27
Author(s):  
Nashrulloh Khoiruzzaman ◽  
Rima Dias Ramadhani ◽  
Apri Junaidi
Keyword(s):  
Cardiovascular Disease ◽  
Chest Pain ◽  
Euclidean Distance ◽  
Nearest Neighbor ◽  
K Nearest Neighbor ◽  
Hidden Layer

Cardiovascular disease adalah penyakit yang diakibatkan oleh kelainan yang terjadi pada organ jantung. Cardivascular disease dapat menyerang manusia dari usia muda hingga usia tua yang terdapat 13 faktor yang mempengaruhinya yaitu Age, Sex, Chest pain, Trestbps, Chol, Fbs, Restecg, Thalach, Exang, Oldpeak, Slope, Ca, dan Thal. Cardiovascular disease beragam jenisnya antara lain penyakit jantung koroner, gagal jantung, tekanan darah tinggi, tekanan darah rendah dan lain-lain. Oleh karena itu, penelitian ini memiliki tujuan untuk melakukan klasifikasi terhadap cardiovascular disease. Pada penelitian ini menggunakan algoritma backpropagation dan algoritma K-nearest neighbor. Langkah awal dilakukan adalah proses perhitungan euclidean distance pada K-NN untuk mencari jarak k terdekat untuk mendapatkan kategori berdasarkan frequensi terbanyak dari nilai k yang ditentukan dan mencari bobot baru untuk algoritma backpropagation untuk mendapatkan bobot baru yang digunakan untuk mendapatkan nilai yang sesuai dengan yang diharapkan. Pengujian sistem ini terdiri dari pengujian nilai akurasi dengan nilai K, pengujian K-fold X validation dan pengaruh hidden layer. Hasil dari Penelitian ini bahwa algoritma backpropagation menghasilkan nilai akurasi sebesar 64%, presisi sebesar 62%, recall sebesar 64% dan algoritma K-nearest neighbor menghasilkan nilai akurasi sebesar 66%, presisi sebesar 61% dan recall sebesar 66%. Pengaruh hidden layer terhadap algoritma backpropagation dalam mengklasifikasikan cardiovascular disease sangat besar hal ini sesuai dengan hasil dari penelitian yang telah dilakukan bahwa ketika jumlah hidden layer kecil, nilai yang dihasilkan juga kecil akan tetapi ketika jumlah hidden layernya tinggi nilai akurasinya bahkan menjadi rendah .

scholarly journals Long Covid: A Review on Cardiovascular Disease (CVD) in Post-Acute Sequalae of SARS-CoV-2 Infection (PASC)

2021 ◽  
Vol 12 (3) ◽  
pp. 3989-3995
Keyword(s):  
Cardiovascular Disease ◽  
Chest Pain ◽  
World Health Organization ◽  
Joint Pain ◽  
Cardiovascular Events ◽  
World Health ◽  
Number Of Patients ◽  
The World ◽  
Surface Receptor ◽  
Health Organization

Coronavirus disease 2019 (COVID-19) caused by the virus SARS-CoV-2 was declared a pandemic by the World Health Organization (WHO) in March 2020. The clinical spectrum of COVID-19 can range from asymptomatic to severe symptoms and even death. Recent studies show that a growing number of patients with COVID-19 will experience prolonged symptoms (Post-Acute Sequalae of SARS-CoV-2), which now days known as “Long Covid”. A team of researchers from Italy reported that nearly 9 in 10 patients discharged were still experiencing at least one symptom 60 days after infection. Symptoms reported are fatigue, dyspnea, joint pain, chest pain, and other uncommon symptoms. Through ACE2 surface receptor, SARS-CoV-2 has been linked to cardiovascular events. As PASC symptoms vary widely, cardiovascular sequelae need to be considered through lifetime management. Therefore, this review aims to summarize an update of the long covid effect on Cardiovascular Disease (CVD), the impacts, and Post-Acute Sequalae of SARS-CoV-2 Infection (PASC) management.

Coronary artery disease--ignored in women or inherently more lethal in women?

1998 ◽  
Vol 7 (1) ◽  
pp. 77-79 ◽  
Author(s):  
KB Keller ◽  
L Lemberg
Keyword(s):  
Risk Factors ◽  
Cardiovascular Disease ◽  
Coronary Artery Disease ◽  
Heart Disease ◽  
Cardiovascular Risk ◽  
Chest Pain ◽  
Coronary Artery ◽  
Noninvasive Testing ◽  
Atypical Chest Pain ◽  
Artery Disease

The leading cause of death in women is cardiovascular disease. The major cardiovascular risk factors have a greater impact on women. The prognosis for women with CAD is worse than for men. Women frequently present with symptoms of heart disease at a much later age and have a greater frequency of atypical chest pain. Noninvasive testing is less reliable in women. Do these facts indicate that CAD is inherently a more lethal disease in women? Or is CAD, as some would suggest, traditionally ignored in women? Stay tuned!

Sign in / Sign up

Export Citation Format

Share Document